PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G24950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 294aa    MW: 32025.4 Da    PI: 7.2709
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G24950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.61.4e-50101471128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF P+deelv++yL+kkv+++++   +++ evd++  ePw+Lp+ +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev  
  OGLUM02G24950.1  10 LPPGFRFFPSDEELVCHYLHKKVANERIAQGSTLVEVDLHAREPWELPEVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVRG 103
                      79*************************999889***************87778889************************************99 PP

              NAM  95 k..........kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +          ++++vg++ktLvfy+grap+g+kt Wvmhe+rl
  OGLUM02G24950.1 104 SssssssssssSRAVVGMRKTLVFYQGRAPNGVKTGWVMHEFRL 147
                      866665555544444***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-587166IPR003441NAC domain
PROSITE profilePS5100557.02810166IPR003441NAC domain
PfamPF023651.3E-2711147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MALREIESTL PPGFRFFPSD EELVCHYLHK KVANERIAQG STLVEVDLHA REPWELPEVA  60
KLTASEWYFF SFRDRKYATG SRTNRATKTG YWKATGKDRE VRGSSSSSSS SSSSSRAVVG  120
MRKTLVFYQG RAPNGVKTGW VMHEFRLDSP HSQPREDWVL CRVFQKRKGD GDGPQDSGGA  180
ASPTFTGSMS TTTLSQLQPP DHRRHAAAAA GGYYVGSQQL AAGYDSAAGF ANPTQPAVPH  240
YQYGGAVIGF PEEFGGGGGV ADEYGFGTYL DLGFELDDTA SVLGGIRSFP QGWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-47516710169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1051220.0AK105122.1 Oryza sativa Japonica Group cDNA clone:001-101-C03, full insert sequence.
GenBankAP0068470.0AP006847.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, fosmid clone:OSJNOa148N02.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624505.11e-140PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLJ22e-60NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D9YV550.0A0A0D9YV55_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G9W20.0A0A0E0G9W2_ORYNI; Uncharacterized protein
STRINGBGIOSGA007201-PA1e-180(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.16e-74NAC domain containing protein 74